Loading...
Statistics
Advertisement

Knock Em Dead Resume Writing & Career Coaching Services
www.knockemdead.com/
Home, Blog & Shop of Martin Yate, NY Times Bestselling Professional Career Coaching, Linkedin & Resume Writing Services Author for over 30 years.

Knockemdead.com

Advertisement
Conversion Technology Metas Server
Knockemdead.com is hosted in United States / Scottsdale . Knockemdead.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Flexslider, Font Awesome, Number of used javascripts: 18. First javascripts: Jquery.min.js, Datepicker.min.js, Add-to-cart.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 6. Its server type is: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4. Its CMS is: Wordpress.

Technologies in use by Knockemdead.com

Technology

Number of occurences: 8
  • CSS
  • Flexslider
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery UI
  • Php

Advertisement

Javascripts

Number of occurences: 18
  • jquery.min.js
  • datepicker.min.js
  • add-to-cart.min.js
  • jquery.blockUI.min.js
  • woocommerce.min.js
  • jquery.cookie.min.js
  • cart-fragments.min.js
  • tracking.min.js
  • cc-widget.js
  • jquery.placeholder.min.js
  • jquery.flexslider-min.js
  • bootstrap.min.js
  • wp-embed.min.js
  • jquery.bxslider.min.js
  • carousel.js
  • count.js
  • E-v1.js
  • default.include-footer.97ff74.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4

Powered by

  • W3 Total Cache/0.9.4.1

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Social

Number of occurences: 1
  • Facebook Box

Used plugins, modules

Number of plugins and modules: 6
  • woocommerce
  • affiliate wp
  • constant contact api
  • logos showcase
  • disqus comment system
  • woocommerce menu bar cart

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Knockemdead.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=knockemdead.com
    • subject:
      • OU: Domain Control Validated
      • CN: knockemdead.com
    • hash: ef13a1de
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 7818338946679018442
    • validFrom: 160120224538Z
    • validTo: 170120224538Z
    • validFrom_time_t: 1453329938
    • validTo_time_t: 1484952338
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-182.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:knockemdead.com, DNS:www.knockemdead.com
      • subjectKeyIdentifier: 72:9A:43:EF:48:FB:71:9E:58:19:E2:0A:AD:AE:A2:ED:D2:0E:A4:55

Meta - Knockemdead.com

Number of occurences: 15
  • Name: google-site-verification
    Content: PZcKKTajljohs6oLgFjusR_eC6E1g5Yd2aiUYiMoaa4
  • Name:
    Content: https://knockemdead.com/wp-content/uploads/2014/12/Logo_RR_v2.png
  • Name: description
    Content: Home, Blog & Shop of Martin Yate, NY Times Bestselling Professional Career Coaching, Linkedin & Resume Writing Services Author for over 30 years.
  • Name: robots
    Content: noodp
  • Name: twitter:card
    Content: summary
  • Name: twitter:description
    Content: Home, Blog & Shop of Martin Yate, NY Times Bestselling Professional Career Coaching, Linkedin & Resume Writing Services Author for over 30 years.
  • Name: twitter:title
    Content: NY Times Bestselling Author Martin Yate's Knock Em' Dead
  • Name: twitter:site
    Content: @knockemdead
  • Name: twitter:image
    Content: https://knockemdead.com/wp-content/uploads/2014/12/Logo_RR_v2.png
  • Name: twitter:creator
    Content: @knockemdead
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: mobile-web-app-capable
    Content: yes
  • Name: apple-mobile-web-app-capable
    Content: yes
  • Name: apple-mobile-web-app-status-bar-style
    Content: black
  • Name: p:domain_verify
    Content: 08e3cebcf2b2de7e7067f87484262450”/>

Server / Hosting

  • IP: 166.62.54.71
  • Latitude: 33.61
  • Longitude: -111.89
  • Country: United States
  • City: Scottsdale

Rname

  • ns25.domaincontrol.com
  • ns26.domaincontrol.com
  • mailstore1.secureserver.net
  • smtp.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Thu, 16 Jun 2016 17:47:38 GMT Server: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 X-Powered-By: W3 Total Cache/0.9.4.1 Location: https://knockemdead.com/ Cache-Control: max-age=2592000 Expires: Sat, 16 Jul 2016 17:47:38 GMT Vary: User-Agent,Accept-Encoding Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Date: Thu, 16 Jun 2016 17:47:40 GMT Server: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 Last-Modified: Thu, 16 Jun 2016 16:26:07 GMT ETag: "8bcf-53567b1fc0288" Accept-Ranges: bytes Content-Length: 35791 Cache-Control: max-age=0, public, public Expires: Thu, 16 Jun 2016 17:47:40 GMT Vary: Accept-Encoding,Cookie X-Pingback: https://knockemdead.com/xmlrpc.php X-Powered-By: W3 Total Cache/0.9.4.1 Pragma: public Content-Type: text/html; charset=UTF-8

DNS

host: knockemdead.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 166.62.54.71
host: knockemdead.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns25.domaincontrol.com
host: knockemdead.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns26.domaincontrol.com
host: knockemdead.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns25.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016060500
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: knockemdead.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net
host: knockemdead.com
  1. class: IN
  2. ttl: 1800
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.nockemdead.com, www.ktnockemdead.com, www.tnockemdead.com, www.knockemdead.com, www.nockemdead.com, www.kgnockemdead.com, www.gnockemdead.com, www.kbnockemdead.com, www.bnockemdead.com, www.knnockemdead.com, www.nnockemdead.com, www.khnockemdead.com, www.hnockemdead.com, www.kynockemdead.com, www.ynockemdead.com, www.klnockemdead.com, www.lnockemdead.com, www.konockemdead.com, www.onockemdead.com, www.kunockemdead.com, www.unockemdead.com, www.kinockemdead.com, www.inockemdead.com, www.kmnockemdead.com, www.mnockemdead.com, www.kockemdead.com, www.knnockemdead.com, www.knockemdead.com, www.knhockemdead.com, www.khockemdead.com, www.knjockemdead.com, www.kjockemdead.com, www.knkockemdead.com, www.kkockemdead.com, www.knlockemdead.com, www.klockemdead.com, www.kn ockemdead.com, www.k ockemdead.com, www.knckemdead.com, www.knobckemdead.com, www.knbckemdead.com, www.knohckemdead.com, www.knhckemdead.com, www.knogckemdead.com, www.kngckemdead.com, www.knojckemdead.com, www.knjckemdead.com, www.knomckemdead.com, www.knmckemdead.com, www.kno ckemdead.com, www.kn ckemdead.com, www.knovckemdead.com, www.knvckemdead.com, www.knokemdead.com, www.knocdkemdead.com, www.knodkemdead.com, www.knocrkemdead.com, www.knorkemdead.com, www.knoctkemdead.com, www.knotkemdead.com, www.knocvkemdead.com, www.knovkemdead.com, www.knocfkemdead.com, www.knofkemdead.com, www.knocgkemdead.com, www.knogkemdead.com, www.knochkemdead.com, www.knohkemdead.com, www.knocnkemdead.com, www.knonkemdead.com, www.knocmkemdead.com, www.knomkemdead.com, www.knocjkemdead.com, www.knojkemdead.com, www.knocemdead.com, www.knocktemdead.com, www.knoctemdead.com, www.knockemdead.com, www.knocemdead.com, www.knockgemdead.com, www.knocgemdead.com, www.knockbemdead.com, www.knocbemdead.com, www.knocknemdead.com, www.knocnemdead.com, www.knockhemdead.com, www.knochemdead.com, www.knockyemdead.com, www.knocyemdead.com, www.knocklemdead.com, www.knoclemdead.com, www.knockoemdead.com, www.knocoemdead.com, www.knockuemdead.com, www.knocuemdead.com, www.knockiemdead.com, www.knociemdead.com, www.knockmemdead.com, www.knocmemdead.com, www.knockmdead.com, www.knockexmdead.com, www.knockxmdead.com, www.knockesmdead.com, www.knocksmdead.com, www.knockewmdead.com, www.knockwmdead.com, www.knockermdead.com, www.knockrmdead.com, www.knockefmdead.com, www.knockfmdead.com, www.knockevmdead.com, www.knockvmdead.com, www.knockecmdead.com, www.knockcmdead.com, www.knockeqmdead.com, www.knockqmdead.com, www.knockeamdead.com, www.knockamdead.com, www.knockeymdead.com, www.knockymdead.com, www.knockedead.com, www.knockempdead.com, www.knockepdead.com, www.knockemodead.com, www.knockeodead.com, www.knockemidead.com, www.knockeidead.com, www.knockemkdead.com, www.knockekdead.com, www.knockem.dead.com, www.knocke.dead.com, www.knockemudead.com, www.knockeudead.com, www.knockemjdead.com, www.knockejdead.com, www.knockemndead.com, www.knockendead.com, www.knockem-dead.com, www.knocke-dead.com, www.knockemead.com, www.knockemdtead.com, www.knockemtead.com, www.knockemdgead.com, www.knockemgead.com, www.knockemdbead.com, www.knockembead.com, www.knockemdxead.com, www.knockemxead.com, www.knockemdsead.com, www.knockemsead.com, www.knockemdfead.com, www.knockemfead.com, www.knockemdvead.com, www.knockemvead.com, www.knockemdyead.com, www.knockemyead.com, www.knockemdzead.com, www.knockemzead.com, www.knockemdaead.com, www.knockemaead.com, www.knockemdeead.com, www.knockemeead.com, www.knockemdread.com, www.knockemread.com,

Other websites we recently analyzed

  1. ROBERTO SOZZI - FINE ART PHOTOGRAPHY
    FINE ART CONTEMPORARY PHOTOGRAPHY
    Arezzo (Italy) - 31.11.33.182
    Server software: Apache
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 11
  2. Arackal
    With over 12 years of experience delivering to clients all over the world, Arackal helps start-ups or well-established companies effectively navigate today's modern technology landscape with a focus o
    Wayne (United States) - 74.208.165.106
    Server software: squid/3.5.9
    Technology: CSS, Flexslider, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 6
  3. wesvirginfatdiminishersystem.com
    Ashburn (United States) - 54.243.49.127
    Server software: Apache/2.2.22 (Debian) mod_qos/10.8
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  4. WAYCO Equipment Ltd
    Wayco Equipment distributes automotive workshop equipment. Brands include Wayco, Rokit Air and KC Tools
    Australia - 202.124.241.203
    Server software: LiteSpeed
    Technology: Html
    Number of Javascript: 2
    Number of meta tags: 5
  5. Tax Sentinel
    San Francisco (United States) - 192.241.207.240
    Server software: Apache/2.4.7 (Ubuntu)
    Technology: BootstrapCDN, Maxcdn, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Wordpress
    Number of Javascript: 17
    Number of meta tags: 3
  6. Personal Injury Attorneys - Accident Lawyers
    If you have been seriously hurt, please contact our skilled personal injury attorneys.
    Herndon (United States) - 64.34.165.173
    G Analytics ID: UA-23139809-4
    Server software: Apache/2.2.22 (Unix) mod_ssl/2.2.22 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 PHP/5.3.14
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 6
  7. Home - Back2Wood
    Germany - 85.13.144.74
    Server software: Apache
    Technology: CSS, Html, Html5, jQuery Colorbox, jQuery UI, MediaElement, Php, Swf Object
    Number of Javascript: 6
    Number of meta tags: 6
  8. nationalapartmentsource.net
    Houston (United States) - 192.254.250.178
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2
  9. gannalyzer.net
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  10. TAG Solutions Home - TAG Solutions
    Chicago (United States) - 209.188.95.228
    G Analytics ID: UA-58783198-1
    Server software: Apache
    Technology: CSS, Font Awesome, Gravatar, Html, Javascript, jQuery, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
    Number of Javascript: 19
    Number of meta tags: 3

Check Other Websites